We collect cookies to analyze our website traffic and performance; we never collect any personal data.Cookies Policy
Accept
Michigan Post
Search
  • Home
  • Trending
  • Michigan
  • World
  • Politics
  • Top Story
  • Business
    • Business
    • Economics
    • Real Estate
    • Startups
    • Autos
    • Crypto & Web 3
  • Tech
  • Lifestyle
    • Lifestyle
    • Food
    • Beauty
    • Art & Books
  • Health
  • Sports
  • Entertainment
  • Education
Reading: Leaked recording reveals high Tory knew of flaws in post-Brexit plan to return unlawful migrants
Share
Font ResizerAa
Michigan PostMichigan Post
Search
  • Home
  • Trending
  • Michigan
  • World
  • Politics
  • Top Story
  • Business
    • Business
    • Economics
    • Real Estate
    • Startups
    • Autos
    • Crypto & Web 3
  • Tech
  • Lifestyle
    • Lifestyle
    • Food
    • Beauty
    • Art & Books
  • Health
  • Sports
  • Entertainment
  • Education
© 2024 | The Michigan Post | All Rights Reserved.
Michigan Post > Blog > Politics > Leaked recording reveals high Tory knew of flaws in post-Brexit plan to return unlawful migrants
Politics

Leaked recording reveals high Tory knew of flaws in post-Brexit plan to return unlawful migrants

By Editorial Board Published May 14, 2025 8 Min Read
Share
Leaked recording reveals high Tory knew of flaws in post-Brexit plan to return unlawful migrants

Boris Johnson repeatedly instructed the general public that Brexit would imply taking again management of Britain’s borders and migration system.

Plans unveiled to ease prisons disaster – politics newest

Mr Philp appeared to counsel the size of the issue shocked these within the Johnson authorities.

Picture:
Chris Philp is the shadow house secretary. Pic: Reuters

“When we did check it out… (we) found that about half the people crossing the Channel had claimed asylum previously elsewhere in Europe.”

In response tonight, the Tories insisted that Mr Philp was not saying the Tories didn’t have a plan for how you can deal with asylum seekers publish Brexit.

Mr Philp’s feedback from final month are a really completely different tone to 2020 when as immigration minister he gave the impression to be suggesting EU membership and the Dublin guidelines hampered asylum removals.

In August that 12 months, he mentioned: “The Dublin regulations do have a number of constraints in them, which makes returning people who should be returned a little bit harder than we would like. Of course, come the 1st of January, we’ll be outside of those Dublin regulations and the United Kingdom can take a fresh approach.”

Mr Philp was additionally immigration minister in Mr Johnson’s authorities so would have been following the talk intently.

xx

Picture:
Philp was beforehand an in depth ally of Liz Truss. Pic: PA

In public, members of the Johnson administration had been claiming this is able to not be a problem since asylum claims could be “inadmissible”, however gave no particulars on how they might really cope with folks bodily arriving within the nation.

A House Workplace supply instructed journalists as soon as the UK is “no longer bound by Dublin after the transition”, then “we will be able to negotiate our own bilateral returns agreement from the end of this year”.

This didn’t occur instantly.

In the summertime of 2020, Mr Johnson’s spokesman criticised the “inflexible and rigid” Dublin laws, suggesting the exit from this settlement could be a welcome post-Brexit freedom. Mr Philp’s feedback counsel a unique view in personal.

The remarks had been made in a Zoom name, a part of a daily collection with all of the shadow cupboard on April 28, simply earlier than the native election.

Mr Philp was requested by a member why international locations like France continued to permit migrants to come back to the UK.

He replied: “The migrants should claim asylum in the first safe place and that under European Union regulations, which is called the Dublin 3 regulation, the first country where they are playing asylum is the one that should process their application.

“Now, as a result of we’re out of the European Union now, we’re out of the Dublin 3 laws, and so we will not any longer depend on sending folks again to the place the place they first claimed asylum. Once we did test it out, simply earlier than we exited the EU transitional preparations on December the thirty first, 2020, we did run some checks and located that about half the folks crossing the channel had claimed asylum beforehand elsewhere in Europe.

“In Germany, France, Italy, Spain, somewhere like that, and therefore could have been returned. But now we’re out of Dublin, we can’t do that, and that’s why we need to have somewhere like Rwanda that we can send these people to as a deterrent.”

Please use Chrome browser for a extra accessible video participant

DARREN JONES CAROLINE LUCAS

1:42

Has Brexit saved the UK from tariffs?

Mr Johnson introduced the Rwanda plan in April 2022 – which Mr Philp casts because the successor plan – 16 months after Britain left the authorized and regulatory regime of the EU, however the plan was blocked by the European Courtroom of Human Rights.

Successive Tory prime ministers did not get any obligatory removals to Rwanda, and Sir Keir Starmer cancelled the programme on coming into Downing Avenue final 12 months, leaving the problem of asylum seekers from France unresolved.

Britain’s membership of the EU didn’t cease all asylum arrivals. Underneath the EU’s Dublin regulation, underneath which individuals must be processed for asylum within the nation at which they first entered the bloc.

Nevertheless, many EU international locations the place folks first arrive, reminiscent of Italy, don’t apply the Dublin guidelines.

The UK shouldn’t be going to have the ability to take part once more within the Dublin settlement since that’s solely open to full members of the EU.

Ministers have confirmed the Labour authorities is discussing a returns settlement with the French that may contain each international locations exchanging folks searching for asylum.

“Of course, that’s going to involve conversations with our counterparts on the European continent.”

Pressed on the returns settlement, Ms Greenwood mentioned: “I can confirm that there are discussions ongoing with the French government about how we stop this appalling and dangerous trade in people that’s happening across the English Channel.”

A Conservative Celebration spokesman mentioned: “The Conservative Party delivered on the democratic will of this country, and left the European Union.

“The final authorities did have a plan and nobody – together with Chris – has ever recommended in any other case.

“We created new deals with France to intercept migrants, signed returns agreements with many countries across Europe, including a landmark agreement with Albania that led to small boat crossings falling by a third in 2023, and developed the Rwanda deterrent – a deterrent that Labour scrapped, leading to 2025 so far being the worst year ever for illegal channel crossings.

“Nevertheless, Kemi Badenoch and Chris Philp have been clear that the Conservatives should do much more to deal with unlawful migration.

“It is why, under new leadership, we are developing g new policies that will put an end to this problem – including disapplying the Human Rights Act from immigration matters, establishing a removals deterrent and deporting all foreign criminals.”

TAGGED:flawsillegalknewleakedmigrantsplanpostBrexitrecordingreturnrevealsTopTory
Share This Article
Facebook Twitter Email Copy Link Print

HOT NEWS

‘It feels just like the wilderness right here now’: The communities shredded and nonetheless stranded by Hurricane Melissa

‘It feels just like the wilderness right here now’: The communities shredded and nonetheless stranded by Hurricane Melissa

World
November 1, 2025
Reform councillor defects to Tories after changing into ‘uncomfortable’ with celebration

Reform councillor defects to Tories after changing into ‘uncomfortable’ with celebration

A Reform UK councillor has defected to the Tories after changing into "uncomfortable" with Nigel…

November 1, 2025
Dodgers pressure Recreation 7 with dramatic World Sequence victory over Blue Jays

Dodgers pressure Recreation 7 with dramatic World Sequence victory over Blue Jays

TORONTO — On Wednesday, the longest night time of the Dodgers’ season acquired dragged into the early…

November 1, 2025
Commentary: Now that is extra prefer it! Dodgers recapture mojo, survive scary World Sequence Recreation 6

Commentary: Now that is extra prefer it! Dodgers recapture mojo, survive scary World Sequence Recreation 6

The Dodgers, it seems, selected the right costume by which to parade on this scariest…

November 1, 2025
Satellite tv for pc photographs present US army edging nearer to Venezuela – as questions raised about Trump’s intentions

Satellite tv for pc photographs present US army edging nearer to Venezuela – as questions raised about Trump’s intentions

Defence knowledgeable and former US army colonel Mark Cancian mentioned the operation might be seen…

November 1, 2025

YOU MAY ALSO LIKE

Motorcyclists plan ride-by for Lansing boy with mind tumors

LANSING, Mich. (WLNS) -- Mid-Michigan motorcyclists -- do not put your bike away simply but. This Sunday, riders are planning…

Michigan
October 31, 2025

Greater than 70 migrants returned to France underneath ‘one in, one out’ scheme

The federal government's 'one in, one out' swap take care of France has to date returned 75 migrants, whereas 51…

Politics
October 31, 2025

Authorities warned towards ‘deplorable’ price range technique

The federal government hinting at an increase in revenue tax on the price range solely to not undergo with it…

Politics
October 31, 2025

‘Manufactured panic’: Immigration not close to prime of most individuals’s issues, ballot suggests

Solely 1 / 4 of individuals suppose immigration is a crucial situation domestically - and concern about it's "a manufactured…

Politics
October 31, 2025

Welcome to Michigan Post, an esteemed publication of the Enspirers News Group. As a beacon of excellence in journalism, Michigan Post is committed to delivering unfiltered and comprehensive news coverage on World News, Politics, Business, Tech, and beyond.

Company

  • About Us
  • Newsroom Policies & Standards
  • Diversity & Inclusion
  • Careers
  • Media & Community Relations
  • Accessibility Statement

Contact Us

  • Contact Us
  • Contact Customer Care
  • Advertise
  • Licensing & Syndication
  • Request a Correction
  • Contact the Newsroom
  • Send a News Tip
  • Report a Vulnerability

Term of Use

  • Digital Products Terms of Sale
  • Terms of Service
  • Privacy Policy
  • Cookie Settings
  • Submissions & Discussion Policy
  • RSS Terms of Service
  • Ad Choices

© 2024 | The Michigan Post | All Rights Reserved

Welcome Back!

Sign in to your account

Lost your password?