We collect cookies to analyze our website traffic and performance; we never collect any personal data.Cookies Policy
Accept
Michigan Post
Search
  • Home
  • Trending
  • Michigan
  • World
  • Politics
  • Top Story
  • Business
    • Business
    • Economics
    • Real Estate
    • Startups
    • Autos
    • Crypto & Web 3
  • Tech
  • Lifestyle
    • Lifestyle
    • Food
    • Beauty
    • Art & Books
  • Health
  • Sports
  • Entertainment
  • Education
Reading: Leaving Afghanistan, teen cricketer needed to burn medals – now she desires proper to play for nation
Share
Font ResizerAa
Michigan PostMichigan Post
Search
  • Home
  • Trending
  • Michigan
  • World
  • Politics
  • Top Story
  • Business
    • Business
    • Economics
    • Real Estate
    • Startups
    • Autos
    • Crypto & Web 3
  • Tech
  • Lifestyle
    • Lifestyle
    • Food
    • Beauty
    • Art & Books
  • Health
  • Sports
  • Entertainment
  • Education
© 2024 | The Michigan Post | All Rights Reserved.
Michigan Post > Blog > World > Leaving Afghanistan, teen cricketer needed to burn medals – now she desires proper to play for nation
World

Leaving Afghanistan, teen cricketer needed to burn medals – now she desires proper to play for nation

By Editorial Board Published March 7, 2025 6 Min Read
Share
Leaving Afghanistan, teen cricketer needed to burn medals – now she desires proper to play for nation

Forward of Worldwide Ladies’s Day, I am fascinated about the hundreds of thousands of Afghan ladies and women who proceed to have their fundamental human rights denied.

Afghanistan is not within the headlines because it as soon as was, however the destiny of Afghan ladies and women ought to hang-out the conscience of humanity.

Within the three and a half years for the reason that Taliban returned to energy, the rights of Afghan ladies and women have been savagely curtailed.

Nowhere else on earth on this century have ladies and women seen their freedoms extra severely and instantly erased.

Picture:
Sprayed out ladies’s faces in Afghanistan. File pic

Whereas some Taliban leaders specific private ambivalence about these insurance policies, the fact is that the battle on ladies is the coverage the Taliban has most constantly and successfully waged for the reason that American withdrawal from Afghanistan.

Even the straightforward freedoms of going to public parks or the gymnasium have been banned. Ladies and women are successfully banned from enjoying all sports activities.

When the Taliban swept to energy, many fled, together with twenty members of the Afghan ladies’s cricket workforce.

Afghanistan women's cricket team

Picture:
Members of the Afghan ladies’s workforce

Some have been beneath 18 after they left, pressured to cover in accommodations to remain secure earlier than being allowed to cross the border into Pakistan and ultimately search asylum in Australia.

Firooza Amiri, 21, and Benafsha Hashimi, 22, are two of those ladies. All they need – all any of those ladies need – is to have the ability to play the game they love on a world stage.

To try this, they’ll must be recognised formally as Afghanistan’s refugee workforce by the Worldwide Cricket Council (ICC). Thus far, their calls have gone unanswered.

“We really don’t know why they are silent,” Firooza says.

Firooza Amiri

Picture:
Firooza Amiri has simply completed highschool when the Taliban returned to energy

When the ladies performed their first high-profile match collectively since arriving in Australia on the finish of January, they could not signify Afghanistan regardless of the nation’s flag punctuating the stands.

In the meantime, the boys’s workforce in Afghanistan retains full ICC membership despite the fact that the nation doesn’t have a ladies’s workforce, which is a requirement of the ICC.

“You see that we are in the same position as [the men’s team] but they are playing in Championship Trophy and we are not,” Firooza says.

Shabnam Eshan, 17, says: “We deserve the opportunity to compete on the world stage… I want to show the world that Afghan women can compete at the highest level.”

Please use Chrome browser for a extra accessible video participant

Cricket - ICC Cricket World Cup 2023 - England v Afghanistan - Arun Jaitley Stadium, New Delhi, India - October 15, 2023 England's Adil Rashid in action REUTERS/Anushree Fadnavis

1:44

From January: Why folks needed cricket match boycotted

Firooza and Benafsha had each simply completed highschool in the summertime of 2021 when their worlds have been turned upside-down.

Firooza had simply acquired a contract to play within the newly established Afghanistan’s nationwide ladies’s workforce. In a matter of days, every part modified, and Firooza was pressured to depart and begin anew in Australia.

She needed to burn all her medals and certificates.

“We have faced so many challenges leaving Afghanistan and starting a new life in Australia,” Firooza informed me.

Their message to the ICC is easy. “Stop ignoring us,” Firooza says.

“This is the time for you to support us, for you to support the team… this is the time you show your support as a governing body and help us play cricket.”

Benafsha provides: “We don’t want anything from them except our rights.”

Benafsha Hashimi

Picture:
Benafsha Hashimi says “we deserve better”

Shortly after the Taliban’s return, I started protecting a day by day tracker of what number of days had handed since women over the age of 12 had been banned from college.

As of seven March, it has been 1,266 days. Guarantees have been made to ladies and their households by the Taliban that ultimately they are going to be permitted to renew their research – maybe after the curriculum has been modified or new uniforms established.

However after practically 4 years, it seems the Taliban has no intention of letting women return to high school.

Regardless of these boundaries, the workforce stays optimistic and says they wish to be a voice for the hundreds of thousands of Afghan ladies and women who’ve been erased from the general public eye and denied their rights of their nation of start.

“What we want is for you [the ICC] to just give us our rights, we deserve better,” says Benafsha.

TAGGED:Afghanistanburncountrycricketerleavingmedalsplayteen
Share This Article
Facebook Twitter Email Copy Link Print

HOT NEWS

Prep speak: Do not say Metropolis Part soccer has no expertise

Prep speak: Do not say Metropolis Part soccer has no expertise

Sports
November 27, 2025
Commentary: Thanks for the trip! 13 moments that outlined the Dodgers’ 2025 World Sequence title run

Commentary: Thanks for the trip! 13 moments that outlined the Dodgers’ 2025 World Sequence title run

p]:text-cms-story-body-color-text clearfix"> They had been going to win. They had been going to lose. Multi…

November 27, 2025
Upbit suffers ‘irregular withdrawals’ of M on sixth anniversary of Lazarus hack

Upbit suffers ‘irregular withdrawals’ of $30M on sixth anniversary of Lazarus hack

South Korean crypto change Upbit has positioned its deposit and withdrawal providers into “emergency maintenance”…

November 27, 2025
The Secret to Having fun with the Holidays With out Burning Out

The Secret to Having fun with the Holidays With out Burning Out

Regardless of how a lot we love them, the vacations have a approach of stretching…

November 27, 2025
HSBC chair candidates to pitch to lender’s board subsequent week

HSBC chair candidates to pitch to lender’s board subsequent week

The remaining candidates to chair HSBC Holdings have been requested to pitch to the board…

November 27, 2025

YOU MAY ALSO LIKE

Girl killed and man injured in shark assault in New South Wales, Australia

A lady has been killed by a shark and a person significantly injured at a well-liked seaside in Australia.Emergency companies…

World
November 27, 2025

Police make arrests over large Hong Kong flats hearth – with dozens killed and extra nonetheless lacking

Three folks have been arrested on suspicion of manslaughter over a lethal hearth which engulfed a high-rise residential complicated in…

World
November 27, 2025

Lindsay and Craig Foreman: Son of British couple detained in Iran says authorities not doing sufficient

The son of a British couple detained in Iran has mentioned the UK authorities will not be doing sufficient to…

World
November 27, 2025

Two Nationwide Guard members shot close to White Home in Washington DC

Two army personnel have been shot close to the White Home in Washington DC.A suspect has been taken into custody…

World
November 26, 2025

Welcome to Michigan Post, an esteemed publication of the Enspirers News Group. As a beacon of excellence in journalism, Michigan Post is committed to delivering unfiltered and comprehensive news coverage on World News, Politics, Business, Tech, and beyond.

Company

  • About Us
  • Newsroom Policies & Standards
  • Diversity & Inclusion
  • Careers
  • Media & Community Relations
  • Accessibility Statement

Contact Us

  • Contact Us
  • Contact Customer Care
  • Advertise
  • Licensing & Syndication
  • Request a Correction
  • Contact the Newsroom
  • Send a News Tip
  • Report a Vulnerability

Term of Use

  • Digital Products Terms of Sale
  • Terms of Service
  • Privacy Policy
  • Cookie Settings
  • Submissions & Discussion Policy
  • RSS Terms of Service
  • Ad Choices

© 2024 | The Michigan Post | All Rights Reserved

Welcome Back!

Sign in to your account

Lost your password?